PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G19000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 285aa    MW: 31230.8 Da    PI: 5.7573
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G19000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.27.7e-13103147347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+++++ + ++ G+g+Wk I+r + k Rt+ q+ s+ qky
      AT1G19000.1 103 PWTENEHKRFLIGLQKVGKGDWKGISRNFVKSRTPTQVASHAQKY 147
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.11696152IPR017930Myb domain
SuperFamilySSF466891.12E-1698152IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1799150IPR006447Myb domain, plants
SMARTSM007171.1E-6100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-10102147IPR009057Homeodomain-like
CDDcd001671.87E-6103148No hitNo description
PfamPF002492.3E-9103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAAVSSSSET GDCGVTGKRD EIMLFGVRVV VDPMRKCVSL NNLSDYEKSS PEDEIPKIVT  60
AGAGDGEDKN ETDATVIVAD GYASANDAVQ ISSSSGGRKR GVPWTENEHK RFLIGLQKVG  120
KGDWKGISRN FVKSRTPTQV ASHAQKYFLR RTNLNRRRRR SSLFDITTET VTEMAMEQDP  180
TQENSPLPET NISSGQQAMQ VFTDVPTKTE NAPETFHLND PYLVPVTFQA KPTFNLNTDA  240
APLSLNLCLA SSFNLNEQPN SRHSAFTMMP SFSDGDSNSS IIRVA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.234130.0flower| inflorescence| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO150280480.0
Genevisible259476_at0.0
Expression AtlasAT1G19000-
AtGenExpressAT1G19000-
ATTED-IIAT1G19000-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G19000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G19000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3168150.0AK316815.1 Arabidopsis thaliana AT1G19000 mRNA, complete cds, clone: RAFL08-11-F04.
GenBankAY0458810.0AY045881.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At1g19000) mRNA, complete cds.
GenBankAY0794150.0AY079415.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At1g19000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173334.10.0myb family transcription factor
RefseqNP_849689.10.0myb family transcription factor
SwissprotQ2V9B04e-56MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLQ9LMC70.0Q9LMC7_ARATH; AT1G19000 protein
STRINGAT1G19000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Representative plantOGRP3941699
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Li Y, et al.
    Establishing glucose- and ABA-regulated transcription networks in Arabidopsis by microarray analysis and promoter classification using a Relevance Vector Machine.
    Genome Res., 2006. 16(3): p. 414-27
    [PMID:16424108]
  3. Oono Y, et al.
    Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays.
    Funct. Integr. Genomics, 2006. 6(3): p. 212-34
    [PMID:16463051]
  4. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]